OBP2A_HUMAN Q9NY56
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NY56
Recommended name：Odorant-binding protein 2a
EC number：
Alternative names：(Odorant-binding protein IIa) (OBPIIa)
Cleaved into：
GeneID：29991
Gene names (primary )：OBP2A
Gene names (synonym )：
Gene names (ORF )：
Length：170
Mass：19318
Sequence：MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Tissue specificity：Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family