P2Y10_HUMAN   O00398


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O00398

Recommended name:Putative P2Y purinoceptor 10

EC number:

Alternative names:(P2Y10) (P2Y-like receptor)

Cleaved into:

GeneID:27334

Gene names  (primary ):P2RY10

Gene names  (synonym ):

Gene names  (ORF ):

Length:339

Mass:38774

Sequence:MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

Tissue specificity:Weakly expressed in blood leukocytes. {ECO:0000269|PubMed:11004484}.

Induction:

Developmental stage:Up-regulated during promyelocytic cell differentiation along the monocytic pathway, but not during granulocytic differentiation.

Protein families:G-protein coupled receptor 1 family