PLAT1_MOUSE   Q9QZU4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZU4

Recommended name:Phospholipase A and acyltransferase 1

EC number:EC 2.3.1.-

Alternative names:(HRAS-like suppressor 1) (HRSL1) (Phospholipid-metabolizing enzyme A-C1)

Cleaved into:

GeneID:27281

Gene names  (primary ):Plaat1

Gene names  (synonym ):Hrasls Hrasrs

Gene names  (ORF ):

Length:167

Mass:18810

Sequence:MAVNDCFSLTYPHNPHPGDLIEVFRPCYQHWALYLGDGYVINIAPIDGIRSSFTSAKSVFSTKALVKMQLLKDVVGNDTYRINNKYDTTYPPLPVEEVIQRSEFPIGQEVAYDLLVNNCEHFVTLLRYGEGVSEQANRAIGTIGLVAAGIDIFTFLGLFPKRQRTKY

Tissue specificity:[Isoform 1]: Expressed in skeletal muscle, heart, brain, bone marrow and testis. {ECO:0000269|PubMed:10542256, ECO:0000269|PubMed:27623847}.; [Isoform 2]: Abundantly expressed in brain, heart, and skeletal muscle. {ECO:0000269|PubMed:27623847}.

Induction:

Developmental stage:

Protein families:H-rev107 family