NNRE_RAT   B0BNM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B0BNM1

Recommended name:NAD(P)H-hydrate epimerase UniRule Annotation

EC number:EC:5.1.99.6

Alternative names:Apolipoprotein A-I-binding protein UniRule Annotation (AI-BP UniRule Annotation) NAD(P)HX epimerase Imported

Cleaved into:

GeneID:295229

Gene names  (primary ):Naxe

Gene names  (synonym ):Aibp, Apoa1bp

Gene names  (ORF ):

Length:282

Mass:30,891

Sequence:MSGLRTLLGLGLLVAGSRLPRIASRQSVCRAGPIWWGTQHRSSETMASAAVKYLSQEEAQAVDEELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPAYPDTECVYRLQ

Tissue specificity:

Induction:

Developmental stage:

Protein families: