KR161_MOUSE   A2A5X5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2A5X5

Recommended name:Keratin-associated protein 16-1

EC number:

Alternative names:

Cleaved into:

GeneID:100504183

Gene names  (primary ):Krtap16-1

Gene names  (synonym ):Gm11570

Gene names  (ORF ):

Length:502

Mass:52020

Sequence:MSGCCCSRKCPSLPAISLCSTEVSCGGPVCLPSSCRSQTWQLVTCEDSCGSSGCGSQCCQPSCSVSSCCQPVCCEATICEPSCSVSSCAQPVCCEATICEPSCSMGSCCQPVCCEATICEPSCSVSTCAQPVCCEATMCQPSCSVSSCQPVCCETSSCQPVLCLPATCQPVICKPCCCQPVICEPSCCSAVCAVPASCQPMICEPVVCEPACCQPVCPTPSCCPSVCSAASSCQPVGCETSPCEPPCSEASACQPSACMALVCEPVCLRPVCCVQGPCEPPCVSSSCQDSSCCVSSICQPVCPEPSPCLPSVCVPTPCQPSCYIVKRCRSVSCEPISCPSPSCQPACCRPGSSASAICQPACPPRTFYIPSSCKPPCSPVSCRPICRPICSGPITFRQPYVTSITYRPACYRSCYSILRRPTCLASYSYRPVCSRQPCTDSDNDKCDSKKPTSSQPDCADSTPVKTEVSDETPCQPSEIKPASPITREAAAPQPAASKPADR

Tissue specificity:

Induction:

Developmental stage:

Protein families:KRTAP type 16 family