GRTP1_MOUSE Q9D3N8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D3N8
Recommended name:Growth hormone-regulated TBC protein 1
EC number:
Alternative names:(TBC1 domain family member 6)
Cleaved into:
GeneID:66790
Gene names (primary ):Grtp1
Gene names (synonym ):Tbc1d6
Gene names (ORF ):
Length:359
Mass:40628
Sequence:MDPAERAQAARARVPRIDPYGFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGGVRKSVTVKRYVRKGIPLEHRARVWMAVSGAQARMDQSPGYYHRLLEGESSSSLDEAIRTDLNRTFPDNVMFRKTADPCLQKTLYNVLLAYGLHNPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILITKNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEASSIPDICDKFKQITKGDFVTECHAFMQKIFSEPGSLSMTTITRLRKSCRAALQAQS
Tissue specificity:Highly expressed in testes, expression greatly increased at postnatal day 20 and remained high up to day 90. Moderately expressed in kidney and liver, weakly expressed in intestine, lung, ovaries and stomach. Expression of Growth hormone increased the expression in testis but decreased expression in liver and kidney. {ECO:0000269|PubMed:11564724}.
Induction:
Developmental stage:Weakly expressed in the testis of the embryo and neonate. {ECO:0000269|PubMed:11564724}.
Protein families: