ETV5_MOUSE Q9CXC9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CXC9
Recommended name：ETS translocation variant 5
EC number：
Alternative names：
Cleaved into：
GeneID：104156
Gene names (primary )：Etv5
Gene names (synonym )：
Gene names (ORF )：
Length：510
Mass：57712
Sequence：MDGFCDQQVPFMVPGKSRSEDCRGRPLIDRKRKFVDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGAKYGEKCLYNYCAYDRKPPSGFKPLTPPATPLSPTHQNSLFPPPQATLPTSGLTPGAGPVQGVGPAPTPHSLPEPGSQQQTFAVPRPPHQPLQMPKMMPESQYPSEQRFQRQLSEPSHPFPPQSGVPGDSRPSYHRQMSEPIVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCADSEVPNCQSSYMRGGYFSSSHEGFPYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECPLNEEDTLPLTHFEDNPAYLLDMDRCSSLPYTEGFAY
Tissue specificity：In the brain, expressed predominantly in the cerebral cortex, the amygdala and the hypothalamus. Within the cerebral cortex, there is conspicuously high expression in cortical layers 2, 4 and 6 while expression is almost absent from layers 1, 3 and 5. High expression is also observed in the dorsal and ventral endopiriform claustrum. Strong expression is observed in limited parts of the amygdala including the basolateral amygdaloid nucleus, the bed stria terminalis and the central amygdaloid nucleus. Low to moderate levels are found in the hypothalamus while expression is almost absent in the thalamus. Hypothalamic expression is seen in the dorsomedial hypothalamic nucleus and also the central, dorsomedial and ventrolateral parts of the ventromedial hypothalamic nucleus. Strong expression is also identified in the nigrostriatal tract. In the mesencephalon, expression is restricted to the ventral tegmental area including the parabrachial pigmented nucleus. In the hippocampus, strongly expressed in the pyramidal cell layer. Some expression is also found in the lacunosum moleculare layer. Low levels of expression in the cerebellum, including the granular, molecular and Purkinje cell layers. {ECO:0000269|PubMed:27280443}.
Induction：
Developmental stage：
Protein families：ETS family