OARD1_HUMAN   Q9Y530


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y530

Recommended name:ADP-ribose glycohydrolase OARD1

EC number:EC:3.5.1.-

Alternative names:(O-acetyl-ADP-ribose deacetylase 1) (Terminal ADP-ribose protein glycohydrolase 1) ([Protein ADP-ribosylglutamate] hydrolase OARD1)

Cleaved into:

GeneID:221443

Gene names  (primary ):OARD1

Gene names  (synonym ):C6orf130 TARG1

Gene names  (ORF ):

Length:152

Mass:17025

Sequence:MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:23481255}.

Induction:

Developmental stage:

Protein families: