UNC4_MOUSE O08934
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08934
Recommended name：Homeobox protein unc-4 homolog
EC number：
Alternative names：(Homeobox protein Uncx4.1)
Cleaved into：
GeneID：22255
Gene names (primary )：Uncx
Gene names (synonym )：Uncx4.1
Gene names (ORF )：
Length：530
Mass：53936
Sequence：MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGLLSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPTAAAKGPGAHGSGIAGSAPVPPGEPPAPGTCDPAFYPSQRSGAGSQPRLGRPADKDTVPCGPGAAATAGLPKASPFSVESLLSDSPPRRKATPANAAATAGLDFTPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGPELVPKDAPPAPPAPPAPPAQASFGTFPGPGGAADPAFARRSPEVVASPGPPAPASFRDLTAAAAESGAGDCADVGTVCPAASPPPPLETSPGPGPRAPSPPGEPATCGAAEPGAATGPSPPEGEEVDMD
Tissue specificity：Expressed in the paraxial mesoderm, in the developing kidney and central nervous system. In the somite, it is restricted to the caudal half of the newly formed somite and sclerotome. In the central nervous system, it is detected in the developing spinal cord, hindbrain, mesencephalon and telencephalon. Expressed in adult and embryonic magnocellular neurons of the hypothalamo-neurohypophysial system. {ECO:0000269|PubMed:10330372, ECO:0000269|PubMed:10545229, ECO:0000269|PubMed:11747084, ECO:0000269|PubMed:11973278, ECO:0000269|PubMed:16461927, ECO:0000269|PubMed:16728472, ECO:0000269|PubMed:17477400, ECO:0000269|PubMed:17531978, ECO:0000269|PubMed:9286595}.
Induction：
Developmental stage：
Protein families：Paired homeobox family, Unc-4 subfamily