NMU_HUMAN   P48645


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48645

Recommended name:Neuromedin-U [Cleaved into: Neuromedin precursor-related peptide 36

EC number:

Alternative names:(NURP36); Neuromedin precursor-related peptide 33(NURP33); Neuromedin-U-25(NmU-25)]

Cleaved into:Neuromedin precursor-related peptide 36 (NURP36); Neuromedin precursor-related peptide 33 (NURP33); Neuromedin-U-25 (NmU-25)

GeneID:10874

Gene names  (primary ):NMU

Gene names  (synonym ):

Gene names  (ORF ):

Length:174

Mass:19741

Sequence:MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI

Tissue specificity:Expressed throughout the enteric nervous system with highest levels being found in the jejunum.

Induction:

Developmental stage:

Protein families:NmU family