NMU_HUMAN P48645
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48645
Recommended name:Neuromedin-U [Cleaved into: Neuromedin precursor-related peptide 36
EC number:
Alternative names:(NURP36); Neuromedin precursor-related peptide 33(NURP33); Neuromedin-U-25(NmU-25)]
Cleaved into:Neuromedin precursor-related peptide 36 (NURP36); Neuromedin precursor-related peptide 33 (NURP33); Neuromedin-U-25 (NmU-25)
GeneID:10874
Gene names (primary ):NMU
Gene names (synonym ):
Gene names (ORF ):
Length:174
Mass:19741
Sequence:MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Tissue specificity:Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
Induction:
Developmental stage:
Protein families:NmU family