CBR4_RAT Q7TS56
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TS56
Recommended name：3-oxoacyl-[acyl-carrier-protein] reductase
EC number：EC:1.1.1.100
Alternative names：3-ketoacyl-[acyl-carrier-protein] reductase beta subunit By Similarity (KAR beta subunit By Similarity) Carbonyl reductase family member 4 (CBR4) Quinone reductase CBR4 (EC:1.6.5.10 By Similarity) . EC:1.6.5.10 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：359725
Gene names (primary )：Cbr4
Gene names (synonym )：
Gene names (ORF )：
Length：236
Mass：25,287
Sequence：MDKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDVHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQGGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEHFKKNIPLGRFGEALEVAHAVVFLLESPYITGHVLIVDGGLQLTA
Tissue specificity：
Induction：
Developmental stage：
Protein families：