NDUF4_MOUSE   Q9D1H6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D1H6

Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4

EC number:

Alternative names:(Hormone-regulated proliferation-associated protein of 20 kDa homolog)

Cleaved into:

GeneID:68493

Gene names  (primary ):Ndufaf4

Gene names  (synonym ):Hrpap20

Gene names  (ORF ):

Length:173

Mass:20082

Sequence:MGARVTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRSQYPEIEEVVSKKDNKLLSLLRDVYVDSKDPVPALPVKVEPRQEPKEFRLPIGNHFDKNITDIPKGKITVVEALTLLNNHKLSPETWTAEKIAQEYYLELKDVNSLLKYFVTFEVKILPPEDRKAIQSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:NDUFAF4 family