MBNL2_MOUSE   Q8C181


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C181

Recommended name:Muscleblind-like protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:105559

Gene names  (primary ):Mbnl2

Gene names  (synonym ):Kiaa4072

Gene names  (ORF ):

Length:373

Mass:40156

Sequence:MALNVAPVRDTKWLTLEVCRQYQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPTIGTNAAISFAPYLAPVTPGVGLVPTEVLPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMTQSTAKALKRPLEATVDLAFPPGALHPLPKRQALEKSNGASTVFNPSVLHYQQALTSAQLQQHTAFIPTVPMMHSATSATVSAATTPATSVPFAATATANQIILK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Muscleblind family