RB33A_HUMAN Q14088
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14088
Recommended name：Ras-related protein Rab-33A
EC number：
Alternative names：(Small GTP-binding protein S10)
Cleaved into：
GeneID：9363
Gene names (primary )：RAB33A
Gene names (synonym )：RABS10
Gene names (ORF )：
Length：237
Mass：26593
Sequence：MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Tissue specificity：Expressed only in lymphoid cell lines.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family