P5F1B_HUMAN Q06416
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06416
Recommended name：Putative POU domain, class 5, transcription factor 1B
EC number：
Alternative names：(Oct4-pg1) (Octamer-binding protein 3-like) (Octamer-binding transcription factor 3-like)
Cleaved into：
GeneID：5462
Gene names (primary )：POU5F1B
Gene names (synonym )：OCT4PG1 OTF3C OTF3P1 POU5F1P1 POU5FLC20 POU5FLC8
Gene names (ORF )：
Length：359
Mass：38588
Sequence：MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVITLGSPMHSN
Tissue specificity：Detected at the mRNA level in several cancer tissues (breast, uterine cervix, lung, thyroid gland, esophagus, colon, urinary bladder, and glioma), but absent in normal tissues. {ECO:0000269|PubMed:16229821, ECO:0000269|PubMed:21341266}.
Induction：
Developmental stage：
Protein families：POU transcription factor family, Class-5 subfamily