CT191_HUMAN   Q9H4R4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H4R4

Recommended name:Putative nuclear receptor corepressor 1-like protein NCOR1P1

EC number:

Alternative names:(Nuclear receptor corepressor 1 pseudogene 1)

Cleaved into:

GeneID:

Gene names  (primary ):NCOR1P1

Gene names  (synonym ):C20orf191

Gene names  (ORF ):

Length:102

Mass:11336

Sequence:MSSSGYPPNQGAFSTEQSHYPPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQNASPSKLSKEELIECMDRVDREIAKVEQQILKLKKKQVKVFV

Tissue specificity:

Induction:

Developmental stage:

Protein families:N-CoR nuclear receptor corepressors family