OR1F1_HUMAN O43749
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43749
Recommended name：Olfactory receptor 1F1
EC number：
Alternative names：(Olfactory receptor 16-35) (OR16-35) (Olfactory receptor 1F10) (Olfactory receptor 1F4) (Olfactory receptor 1F5) (Olfactory receptor 1F6) (Olfactory receptor 1F7) (Olfactory receptor 1F8) (Olfactory receptor 1F9) (Olfactory receptor OR16-4)
Cleaved into：
GeneID：4992
Gene names (primary )：OR1F1
Gene names (synonym )：OLFMF OR1F10 OR1F4 OR1F5 OR1F6 OR1F7 OR1F8 OR1F9
Gene names (ORF )：
Length：312
Mass：34866
Sequence：MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVVFSV
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family