OR1E1_HUMAN P30953
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30953
Recommended name:Olfactory receptor 1E1
EC number:
Alternative names:(Olfactory receptor 13-66) (OR13-66) (Olfactory receptor 17-2/17-32) (OR17-2) (OR17-32) (Olfactory receptor 1E5) (Olfactory receptor 1E6) (Olfactory receptor 5-85) (OR5-85) (Olfactory receptor OR17-18) (Olfactory receptor-like protein HGMP07I)
Cleaved into:
GeneID:8387
Gene names (primary ):OR1E1
Gene names (synonym ):OR1E5 OR1E6 OR1E9P
Gene names (ORF ):
Length:314
Mass:35264
Sequence:MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL
Tissue specificity:
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family