NP1L4_HUMAN Q99733
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99733
Recommended name:Nucleosome assembly protein 1-like 4
EC number:
Alternative names:(Nucleosome assembly protein 2) (NAP-2)
Cleaved into:
GeneID:4676
Gene names (primary ):NAP1L4
Gene names (synonym ):NAP2
Gene names (ORF ):
Length:375
Mass:42823
Sequence:MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV
Tissue specificity:Ubiquitous. Biallelically expressed in fetal and adult tissues. Highest levels in testis. {ECO:0000269|PubMed:8923002}.
Induction:
Developmental stage:
Protein families:Nucleosome assembly protein (NAP) family