SMYD2_MOUSE Q8R5A0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R5A0
Recommended name：N-lysine methyltransferase SMYD2
EC number：EC 2.1.1.-
Alternative names：(Histone methyltransferase SMYD2) (SET and MYND domain-containing protein 2)
Cleaved into：
GeneID：226830
Gene names (primary )：Smyd2
Gene names (synonym )：
Gene names (ORF )：
Length：433
Mass：49567
Sequence：MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Tissue specificity：Highly expressed in heart, skeletal muscle and brain tissue. During cardiac development, it is differentially expressed with highest expression in the neonatal heart while very low expression is detected at E12.5 and adult. Specifically expressed in cardiomyocytes (at protein level). {ECO:0000269|PubMed:20305823}.
Induction：
Developmental stage：
Protein families：Class V-like SAM-binding methyltransferase superfamily