TPC2L_HUMAN   Q9UL33


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UL33

Recommended name:Trafficking protein particle complex subunit 2-like protein

EC number:

Alternative names:

Cleaved into:

GeneID:51693

Gene names  (primary ):TRAPPC2L

Gene names  (synonym ):

Gene names  (ORF ):HSPC126

Length:140

Mass:16146

Sequence:MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC

Tissue specificity:Expressed in testis, liver, bladder, lung, spleen and brain, several cell lines and primary chondrocytes cell line. {ECO:0000269|PubMed:19416478}.

Induction:

Developmental stage:

Protein families:TRAPP small subunits family, Sedlin subfamily