PBX2_MOUSE   O35984


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35984

Recommended name:Pre-B-cell leukemia transcription factor 2

EC number:

Alternative names:(Homeobox protein PBX2)

Cleaved into:

GeneID:18515

Gene names  (primary ):Pbx2

Gene names  (synonym ):

Gene names  (ORF ):

Length:430

Mass:45809

Sequence:MDERLLGPPPPGGGRGGLGLVGAEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAVKTAVSVAQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMPGLNGDSYPASQVESLRHSMGPGSYGDNIGGGQIYSPREIRANGGWQEAVTPSSVTSPTEGPGSVHSDTSN

Tissue specificity:

Induction:

Developmental stage:

Protein families:TALE/PBX homeobox family