H2AX_HUMAN   P16104


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P16104

Recommended name:Histone H2AX

EC number:

Alternative names:(H2a/x) (Histone H2A.X)

Cleaved into:

GeneID:3014

Gene names  (primary ):H2AX

Gene names  (synonym ):H2AFX

Gene names  (ORF ):

Length:143

Mass:15145

Sequence:MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Tissue specificity:

Induction:

Developmental stage:Synthesized in G1 as well as in S-phase.

Protein families:Histone H2A family