CHP3_HUMAN Q96BS2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96BS2
Recommended name：Calcineurin B homologous protein 3
EC number：
Alternative names：(Tescalcin) (TSC)
Cleaved into：
GeneID：54997
Gene names (primary )：TESC
Gene names (synonym )：CHP3
Gene names (ORF )：
Length：214
Mass：24750
Sequence：MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
Tissue specificity：Expressed in mature megakaryocytes and polymorphonuclear granulocytes (at protein level). Abundantly expressed in heart. Also expressed at a lower level in adult testis and salivary gland, and in the placenta. {ECO:0000269|PubMed:11696366, ECO:0000269|PubMed:20060826}.
Induction：Up-regulated during granulocytic differentiation in a ERK-dependent manner (is mediated by activation of ERK) (at protein level). Up-regulated during the differentiation and maturation of primary megakaryocytes. Down-regulated during monocytic-macrophage differentiation in a ERK-dependent manner. {ECO:0000269|PubMed:17717601, ECO:0000269|PubMed:20060826}.
Developmental stage：Strongly up-regulated in K562 cells treated by PMA to promote megakaryocytic differentiation, but not when treated by DMSO to promote granulocytic differentiation or by hemin to promote erythroid differentiation (at protein level). {ECO:0000269|PubMed:17717601}.
Protein families：Calcineurin regulatory subunit family, CHP subfamily