PIMRE_HUMAN Q9BSJ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BSJ6
Recommended name：Protein PIMREG
EC number：
Alternative names：(CALM-interactor expressed in thymus and spleen) (PICALM-interacting mitotic regulator) (Regulator of chromosome segregation protein 1)
Cleaved into：
GeneID：54478
Gene names (primary )：PIMREG
Gene names (synonym )：CATS FAM64A RCS1
Gene names (ORF )：
Length：248
Mass：27480
Sequence：MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP
Tissue specificity：Expressed in thymus (at protein level). Detected in spleen, colon, ovary and small intestines. {ECO:0000269|PubMed:16491119, ECO:0000269|PubMed:19383357}.
Induction：
Developmental stage：Regulated in a cell-cycle dependent manner, with lowest levels in quiescent cells or at G1 phase. Progressive up-regulation starting at S phase and peaking at G2 and G2/M phases, followed by a drastic drop as cells exit mitosis (at protein level). {ECO:0000269|PubMed:18757745}.
Protein families：