CK2N1_HUMAN   Q7Z7J9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z7J9

Recommended name:Calcium/calmodulin-dependent protein kinase II inhibitor 1

EC number:

Alternative names:(CaMKII inhibitory protein alpha) (CaMKIIN-alpha)

Cleaved into:

GeneID:55450

Gene names  (primary ):CAMK2N1

Gene names  (synonym ):

Gene names  (ORF ):

Length:78

Mass:8553

Sequence:MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

Tissue specificity:Widely expressed. Nor detected in skeletal muscle. {ECO:0000269|PubMed:18305109}.

Induction:

Developmental stage:Regulated in a cell cycle-dependent manner: abundant at S and G2/M phases and low in G0/G1 phase.

Protein families:CAMK2N family