LENEP_RAT   Q9WVB7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WVB7

Recommended name:Lens epithelial cell protein LEP503

EC number:

Alternative names:

Cleaved into:

GeneID:113917

Gene names  (primary ):Lenep

Gene names  (synonym ):Lep503

Gene names  (ORF ):

Length:61

Mass:6,925

Sequence:MKPPMQPLTQALPFSLRDALQGTGLRVPVIKMGTGWEGMYRTLKEVAYILLCCWCIKELLD

Tissue specificity:Preferentially expressed in the lens epithelial cells.

Induction:

Developmental stage:

Protein families: