F229B_RAT   B0BND4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B0BND4

Recommended name:Protein FAM229B

EC number:

Alternative names:

Cleaved into:

GeneID:100188933

Gene names  (primary ):Fam229b

Gene names  (synonym ):

Gene names  (ORF ):

Length:80

Mass:8,797

Sequence:MPFRFGTQPRRFPVEGGDSSIELESGLSSSASCNGKETSPNRQLRRCPGSHCLTITDVPITVYATMRKPPAQSSKEMRPK

Tissue specificity:

Induction:

Developmental stage:

Protein families: