H1T_HUMAN P22492
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22492
Recommended name：Histone H1t
EC number：
Alternative names：(Testicular H1 histone)
Cleaved into：
GeneID：3010
Gene names (primary )：H1-6
Gene names (synonym )：H1FT H1T HIST1H1T
Gene names (ORF )：
Length：207
Mass：22019
Sequence：MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK
Tissue specificity：Testis-specific. {ECO:0000269|PubMed:1889752, ECO:0000269|PubMed:8175896}.
Induction：
Developmental stage：This histone is a testis-specific H1 variant that appears during meiosis in spermatogenesis. {ECO:0000269|PubMed:8175896}.
Protein families：Histone H1/H5 family