PAF15_HUMAN Q15004
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15004
Recommended name：PCNA-associated factor
EC number：
Alternative names：(Hepatitis C virus NS5A-transactivated protein 9) (HCV NS5A-transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC-1) (PCNA-associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA-clamp-associated factor)
Cleaved into：
GeneID：9768
Gene names (primary )：PCLAF
Gene names (synonym )：KIAA0101 NS5ATP9 PAF
Gene names (ORF )：L5
Length：111
Mass：11986
Sequence：MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Tissue specificity：Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas, adrenocortical carcinomas, and in non-small-cell lung cancer lines. {ECO:0000269|PubMed:11313979, ECO:0000269|PubMed:15789362, ECO:0000269|PubMed:22096502}.
Induction：By UV irradiation. By ATF3 in response to UV-stress. {ECO:0000269|PubMed:16288740, ECO:0000269|PubMed:19219066}.
Developmental stage：Present only during S and G2 phases of the cell cycle. Peaks at the G2/M phase of the cell cycle and drops rapidly at mitotic exit in an APC/C-dependent manner (at protein level).
Protein families：