ZNF12_HUMAN   P17014


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17014

Recommended name:Zinc finger protein 12

EC number:

Alternative names:(Gonadotropin-inducible ovary transcription repressor 3) (GIOT-3) (Zinc finger protein 325) (Zinc finger protein KOX3)

Cleaved into:

GeneID:7559

Gene names  (primary ):ZNF12

Gene names  (synonym ):GIOT3 KOX3 ZNF325

Gene names  (ORF ):

Length:697

Mass:81202

Sequence:MNKSLGPVSFKDVAVDFTQEEWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVEGEFLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISSDGSYARMKADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILEKPFEYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPYECSECGKSFCKKSKFIIHQRTHTGEKPYECNQCGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRKSTLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMRHQRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHTGEKAYECYECGKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYECTECGKKFYHKSAFNSHQRIHRRGNMNVIDVGRLL

Tissue specificity:Widely expressed in various adult tissues and embryonic developmental stages (isoform 3). {ECO:0000269|PubMed:16806083}.

Induction:

Developmental stage:Shows a relatively higher expression level in the fetal brain and a lower level in adult. The expression level in liver is highest at 16 weeks of development and declines from 16 to 24 weeks and is lower in adult. Expressed strongly in fetal heart on 18 and 24 weeks, but relatively weakly on the other development stage of embryo, and then reaches a higher level in adult (isoform 3). {ECO:0000269|PubMed:16806083}.

Protein families:Krueppel C2H2-type zinc-finger protein family