ANGL8_HUMAN   Q6UXH0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UXH0

Recommended name:Angiopoietin-like protein 8

EC number:

Alternative names:(Betatrophin) (Lipasin) (Refeeding-induced fat and liver protein)

Cleaved into:

GeneID:55908

Gene names  (primary ):ANGPTL8

Gene names  (synonym ):C19orf80 RIFL

Gene names  (ORF ):UNQ599/PRO1185

Length:198

Mass:22105

Sequence:MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Tissue specificity:Predominantly expressed in liver. Also expressed in adipose tissues. {ECO:0000269|PubMed:22569073, ECO:0000269|PubMed:22809513}.

Induction:In response to food intake. Stimulated by insulin. {ECO:0000269|PubMed:22569073, ECO:0000269|PubMed:23150577}.

Developmental stage:Transcripts are up-regulated by 100 fold during adipogenesis. {ECO:0000269|PubMed:22569073}.

Protein families:ANGPTL8 family