MPTX_HUMAN   A8MV57


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A8MV57

Recommended name:Putative mucosal pentraxin homolog

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):MPTX1

Gene names  (synonym ):MPTX

Gene names  (ORF ):

Length:137

Mass:15138

Sequence:MGMYLLHIGNAAVTFNGPTPCPRSPYASTHVNVSWESASGIATLWANGKLVGRKGVWKGYSVGEEAKIILGQEQDSFGGHFDENQSFVGVIWDVFLWDHVLPPKEMCDSCYSGSLLNRHTLTYEDNGYVVTKPKVWA

Tissue specificity:Not expressed in the intestinal tract including ascending colon, descending colon and rectum. Not expressed in the human colon cancer cell lines HT-29 and CaCo-2. {ECO:0000269|PubMed:18850182}.

Induction:

Developmental stage:

Protein families:Pentraxin family


   💬 WhatsApp