CRUM3_HUMAN Q9BUF7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BUF7
Recommended name：Protein crumbs homolog 3
EC number：
Alternative names：
Cleaved into：
GeneID：92359
Gene names (primary )：CRB3
Gene names (synonym )：
Gene names (ORF )：UNQ588/PRO1158
Length：120
Mass：12854
Sequence：MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
Tissue specificity：Preferentially expressed in epithelial tissues (PubMed:14718572). Expressed at high levels in lung, kidney, and colon (PubMed:12527193, PubMed:14718572). Expressed at high levels in retina, colon and mammary glands (PubMed:12527193). Moderately expressed in liver, spleen, pancreas and prostate (PubMed:12527193). Moderately to weakly expressed in the placenta (PubMed:14718572, PubMed:12527193). Weakly expressed in skeletal muscle and small intestine (PubMed:14718572). {ECO:0000269|PubMed:12527193, ECO:0000269|PubMed:14718572}.
Induction：
Developmental stage：
Protein families：