ZNAS1_HUMAN   Q8N0V1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N0V1

Recommended name:Putative uncharacterized protein ZNF295-AS1

EC number:

Alternative names:(ZNF295 antisense RNA 1) (ZNF295 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):ZNF295-AS1

Gene names  (synonym ):C21orf121 NCRNA00318

Gene names  (ORF ):PRED87

Length:137

Mass:14971

Sequence:MKDKMWCEDTAQPHRRLPAPPSSSSPTVVFQSHRRLLAPPSSSWTLWVAPRCGCCSPLCPKRVCASLCRVLAVTWSLTKLPFPLSPILLSRPGWLPQPSSPGPACAEPSSQEGGDTDLRSYGCFVCGWAWPTLSPRP

Tissue specificity:

Induction:

Developmental stage:

Protein families: