TSSK6_HUMAN Q9BXA6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXA6
Recommended name：Testis-specific serine/threonine-protein kinase 6
EC number：EC:2.7.11.1
Alternative names：(TSK-6) (TSSK-6) (Testis-specific kinase 6) (Cancer/testis antigen 72) (CT72) (Serine/threonine-protein kinase SSTK) (Small serine/threonine kinase)
Cleaved into：
GeneID：83983
Gene names (primary )：TSSK6
Gene names (synonym )：SSTK
Gene names (ORF )：FKSG82
Length：273
Mass：30331
Sequence：MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Tissue specificity：Highly expressed in testis. Expressed at lower levels in colon, small intestine, ovary, prostate, thymus, spleen and peripheral blood leukocytes. {ECO:0000269|PubMed:15870294}.
Induction：
Developmental stage：
Protein families：Protein kinase superfamily, CAMK Ser/Thr protein kinase family