CCNC_HUMAN   P24863


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P24863

Recommended name:Cyclin-C

EC number:

Alternative names:(SRB11 homolog) (hSRB11)

Cleaved into:

GeneID:892

Gene names  (primary ):CCNC

Gene names  (synonym ):

Gene names  (ORF ):

Length:283

Mass:33243

Sequence:MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Tissue specificity:Highest levels in pancreas. High levels in heart, liver, skeletal muscle and kidney. Low levels in brain.

Induction:

Developmental stage:

Protein families:Cyclin family, Cyclin C subfamily


   💬 WhatsApp