PRAC1_HUMAN   Q96KF2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KF2

Recommended name:Small nuclear protein PRAC1

EC number:

Alternative names:(Prostate cancer susceptibility candidate protein 1) (Prostate, rectum and colon expressed gene protein)

Cleaved into:

GeneID:84366

Gene names  (primary ):PRAC1

Gene names  (synonym ):C17orf92 PRAC

Gene names  (ORF ):

Length:57

Mass:5959

Sequence:MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP

Tissue specificity:Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines. {ECO:0000269|PubMed:11340635}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp