PROF2_HUMAN   P35080


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35080

Recommended name:Profilin-2

EC number:

Alternative names:(Profilin II)

Cleaved into:

GeneID:5217

Gene names  (primary ):PFN2

Gene names  (synonym ):

Gene names  (ORF ):

Length:140

Mass:15046

Sequence:MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Tissue specificity:Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Induction:

Developmental stage:

Protein families:Profilin family


   💬 WhatsApp