SRSF8_HUMAN   Q9BRL6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BRL6

Recommended name:Serine/arginine-rich splicing factor 8

EC number:

Alternative names:(Pre-mRNA-splicing factor SRP46) (Splicing factor SRp46) (Splicing factor, arginine/serine-rich 2B)

Cleaved into:

GeneID:10929

Gene names  (primary ):SRSF8

Gene names  (synonym ):SFRS2B SRP46

Gene names  (ORF ):

Length:282

Mass:32288

Sequence:MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS

Tissue specificity:Strongly expressed in pancreas, spleen and prostate. Weakly expressed in lung, liver and thymus. {ECO:0000269|PubMed:9671500}.

Induction:

Developmental stage:

Protein families:Splicing factor SR family


   💬 WhatsApp