KAPCG_HUMAN P22612
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22612
Recommended name：cAMP-dependent protein kinase catalytic subunit gamma
EC number：EC:2.7.11.11
Alternative names：(PKA C-gamma)
Cleaved into：
GeneID：5568
Gene names (primary )：PRKACG
Gene names (synonym )：
Gene names (ORF )：
Length：351
Mass：40434
Sequence：MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Tissue specificity：Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
Induction：
Developmental stage：
Protein families：Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily