MTCP1_HUMAN   P56278


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56278

Recommended name:Protein p13 MTCP-1

EC number:

Alternative names:(p13MTCP1) (Mature T-cell proliferation-1 type B1) (MTCP-1 type B1)

Cleaved into:

GeneID:4515

Gene names  (primary ):MTCP1

Gene names  (synonym ):C6.1B

Gene names  (ORF ):

Length:107

Mass:12600

Sequence:MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Tissue specificity:Not found at a significant level in any tissue.

Induction:

Developmental stage:

Protein families:TCL1 family


   💬 WhatsApp