RT10_HUMAN P82664
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82664
Recommended name：28S ribosomal protein S10, mitochondrial
EC number：
Alternative names：(MRP-S10) (S10mt) (Mitochondrial small ribosomal subunit protein uS10m)
Cleaved into：
GeneID：55173
Gene names (primary )：MRPS10
Gene names (synonym )：
Gene names (ORF )：MSTP040
Length：201
Mass：22999
Sequence：MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uS10 family