I22R2_HUMAN   Q969J5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969J5

Recommended name:Interleukin-22 receptor subunit alpha-2

EC number:

Alternative names:(IL-22 receptor subunit alpha-2) (IL-22R-alpha-2) (IL-22RA2) (Cytokine receptor class-II member 10) (Cytokine receptor family 2 member 10) (CRF2-10) (Cytokine receptor family type 2, soluble 1) (CRF2-S1) (Interleukin-22-binding protein) (IL-22BP) (IL22BP) (ZcytoR16)

Cleaved into:

GeneID:116379

Gene names  (primary ):IL22RA2

Gene names  (synonym ):

Gene names  (ORF ):UNQ5793/PRO19598/PRO19822

Length:263

Mass:30550

Sequence:MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP

Tissue specificity:Expressed in placenta, spleen, breast, skin and lung. Also detected in intestinal tract, testis, brain, heart and thymus. No expression found in prostate, bladder, kidney, ovary, muscle, bone marrow, liver and uterus. Isoform 1 is expressed only in placenta. Isoform 2 is expressed in placenta and breast and at lower level in spleen, skin, thymus and stomach. {ECO:0000269|PubMed:11481447, ECO:0000269|PubMed:11607789, ECO:0000269|PubMed:15201862}.

Induction:

Developmental stage:

Protein families:Type II cytokine receptor family


   💬 WhatsApp