HMGB2_HUMAN   P26583


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P26583

Recommended name:High mobility group protein B2

EC number:

Alternative names:(High mobility group protein 2) (HMG-2)

Cleaved into:

GeneID:3148

Gene names  (primary ):HMGB2

Gene names  (synonym ):HMG2

Gene names  (ORF ):

Length:209

Mass:24034

Sequence:MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Tissue specificity:Expressed in gastric and intestinal tissues (at protein level). {ECO:0000269|PubMed:23877675}.

Induction:

Developmental stage:

Protein families:HMGB family


   💬 WhatsApp