N6MT1_HUMAN   Q9Y5N5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5N5

Recommended name:Methyltransferase N6AMT1

EC number:EC:2.1.1.-

Alternative names:(HemK methyltransferase family member 2) (M.HsaHemK2P) (Lysine N-methyltransferase 9) (Methylarsonite methyltransferase N6AMT1) (Protein N(5)-glutamine methyltransferase)

Cleaved into:

GeneID:29104

Gene names  (primary ):N6AMT1

Gene names  (synonym ):C21orf127 HEMK2 KMT9 PRED28

Gene names  (ORF ):

Length:214

Mass:22957

Sequence:MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Tissue specificity:Widely expressed, with highest expression in parathyroid and pituitary glands, followed by adrenal gland and kidney, and lowest expression in leukocytes and mammary gland. {ECO:0000269|PubMed:21193388}.

Induction:

Developmental stage:

Protein families:Eukaryotic/archaeal PrmC-related family


   💬 WhatsApp