CR021_HUMAN   Q32NC0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q32NC0

Recommended name:UPF0711 protein C18orf21

EC number:

Alternative names:(HBV X-transactivated gene 13 protein) (HBV XAg-transactivated protein 13)

Cleaved into:

GeneID:83608

Gene names  (primary ):C18orf21

Gene names  (synonym ):XTP13

Gene names  (ORF ):PNAS-124 PNAS-131

Length:220

Mass:24827

Sequence:MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQKLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK

Tissue specificity:

Induction:

Developmental stage:

Protein families:UPF0711 family


   💬 WhatsApp