PP13_HUMAN Q9UHV8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UHV8
Recommended name：Galactoside-binding soluble lectin 13
EC number：
Alternative names：(Galectin-13) (Gal-13) (Placental tissue protein 13) (PP13) (Placental protein 13)
Cleaved into：
GeneID：29124
Gene names (primary )：LGALS13
Gene names (synonym )：PLAC8
Gene names (ORF )：
Length：139
Mass：16119
Sequence：MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Tissue specificity：Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta. Placental expression originates predominantly from the syncytiotrophoblast. {ECO:0000269|PubMed:10527825, ECO:0000269|PubMed:19497882}.
Induction：
Developmental stage：
Protein families：