LEG10_HUMAN   Q05315


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q05315

Recommended name:Galectin-10

EC number:

Alternative names:(Gal-10) (Charcot-Leyden crystal protein) (CLC) (Eosinophil lysophospholipase) (Lysolecithin acylhydrolase)

Cleaved into:

GeneID:1178

Gene names  (primary ):CLC

Gene names  (synonym ):LGALS10 LGALS10A

Gene names  (ORF ):

Length:142

Mass:16453

Sequence:MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Tissue specificity:Expressed abundantly in the bone marrow. Expressed exclusively by eosinophils and basophils. Not detected in monocytes and neutrophils. Expressed in CD25-positive regulatory T-cells (Treg) (at protein level). Found in intestinal tissue from patients with Celiac disease, expression is directly related to the histological grade of mucosal damage and to the number of eosinophils found in the duodenal lesion (at protein level). Found in sputum of patients with eosinophilic inflammatory diseases such as asthma (at protein level). {ECO:0000269|PubMed:17502455, ECO:0000269|PubMed:19497882, ECO:0000269|PubMed:19758173, ECO:0000269|PubMed:22880030}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp