EXOS3_HUMAN   Q9NQT5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NQT5

Recommended name:Exosome complex component RRP40

EC number:

Alternative names:(Exosome component 3) (Ribosomal RNA-processing protein 40) (p10)

Cleaved into:

GeneID:51010

Gene names  (primary ):EXOSC3

Gene names  (synonym ):RRP40

Gene names  (ORF ):CGI-102

Length:275

Mass:29572

Sequence:MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRP40 family


   💬 WhatsApp